Recombinant Human Uncarboxylated Osteocalcin (ELISA Std.)

Pricing & Availability
Regulatory Status
RUO
Other Names
Osteocalcin, uncarboxylated osteocalcin, decarboxylated osteocalcin, 3xGlu, bone gamma-carboxyglutamate protein, Bone Gla Protein, BGP, OC, OCN, unOCN
Ave. Rating
Submit a Review
Product Citations
publications
RECOM_Human_Uncarboxylated-Osteocalcin_1_112719
Representative sandwich immunoassay standard curve generated using serial dilutions of Human Uncarboxylated Osteocalcin (Cat. No. 446709) ranging from 37.5 to 2400 pg/mL, 8H4 (Cat. No. 538202) as the capture antibody at 4 µg/mL, and 4B6 (Cat. No. 538304) as the detection antibody at 0.5 µg/mL.
  • RECOM_Human_Uncarboxylated-Osteocalcin_1_112719
    Representative sandwich immunoassay standard curve generated using serial dilutions of Human Uncarboxylated Osteocalcin (Cat. No. 446709) ranging from 37.5 to 2400 pg/mL, 8H4 (Cat. No. 538202) as the capture antibody at 4 µg/mL, and 4B6 (Cat. No. 538304) as the detection antibody at 0.5 µg/mL.
Cat # Size Price Quantity Check Availability Save
446709 4 pack 76€
Check Availability


Need larger quantities of this item?
Request Bulk Quote
Description

Osteocalcin is the most abundant non-collagenous protein found in the bone. While fully-carboxylated osteocalcin has a high affinity for the extracellular matrix of the bone; decreases in pH, caused by the process of bone resorption, result in decarboxylation of this protein. This generates both partially decarboxylated (undercarboxylated) and fully decarboxylated (uncarboxylated) osteocalcin molecules which are released into the circulation due to decreased affinity for the extracellular matrix. Fully carboxylated osteocalcin requires high calcium concentrations for proper protein folding; however, under/uncarboxylated osteocalcin has no calcium requirement to maintain its structure within the blood.

Product Details
Technical Data Sheet (pdf)

Product Details

Source
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (synthetic peptide)
Molecular Mass
33.2 kD
Purity
> 90%
Formulation
Lyophilized in sterile-filtered PBS, pH 7.2, containing 1% BSA, 0.09% sodium azide, and protease inhibitors
Concentration
Lot-specific (to obtain lot-specific concentration and expiration, please enter the lot number in our Certificate of Analysis online tool.)
Storage & Handling
Unopened vials can be stored between 2°C and 8°C until the expiration date. Prior to use, reconstitute the lyophilized powder with 0.2 mL of PBS containing a carrier protein (e.g., 1% BSA, protease free), pH7.4. Re-cap vial, vortex. Allow the reconstituted standard to sit at room temperature for 15 minutes, vortex again to mix completely. The reconstituted standard stock solution can be aliquoted into polypropylene vials and stored at -70°C for up to one month. Do not re-use diluted standards. Avoid repeated freeze/thaw cycles.
Activity
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
It is a synthetic peptide (did not test activity)
Application

ELISA - Quality tested

Recommended Usage

Each lot of this protein is quality control tested by ELISA assay. For use as an ELISA standard, a standard curve comprised of doubling dilutions from 37.5 - 2400 pg/mL is suggested. It is recommended that the reagent be titrated for optimal performance for each application.

Application Notes

This Uncarboxylated Osteocalcin protein is useful as a standard for a human Osteocalcin sandwich ELISA, using unlabeled 8H4 antibody (Cat. No. 538202) as capture and biotinylated 4B6 antibody (Cat. No. 538304) as detection.

Antigen Details

Structure
Monomer
Distribution

Osteocalcin  is produced by osteoblasts as a 49 amino acid protein, which contains 3 glutamine acid residues (Glu 17, 21, and 24) that are gamma carboxylated in a vitamin K dependent manner.

Function
Once binded under/uncarboxylated forms act as hormones promoting β-cell proliferation, adiponectin secretion, insulin sensitivity, glucose tolerance, and testosterone biosynthesis. In patients with diabetes, reduced serum levels of osteocalcin are negatively correlated with obesity and insulin resistance. Furthermore, supporting studies in mice have suggested potential therapeutic applications for osteocalcin in both obesity and insulin resistance.
Interaction
GPRC6A, insulin, pancreatic β-cells, Ley-dig cells, adiponectin
Ligand/Receptor
Under/uncarboxylated forms can bind the receptor GPCR6a, calcium, and metal-binding.
Bioactivity
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Immunogen is a synthetic peptide (did not test activity)
Cell Type
Osteoblasts
Molecular Family
Hormones
Antigen References
  1. Booth SL, et al. 2013. Nat Rev Endocrinol. 9:43.
  2. Diaz-Franco MC, et al. 2019. Mol Med Rep. 19:15-22.
  3. Karsenty G, et al. 2014. Mol Cell Endocrinol. 382:521.
  4. Zoch ML, et al. 2016. Bone. 82:42-9.
Gene ID
632 View all products for this Gene ID
UniProt
View information about Uncarboxylated Osteocalcin on UniProt.org

Customers Also Purchased

Go To Top Version: 1    Revision Date: 11/27/2019

For Research Use Only. Not for diagnostic or therapeutic use.

 

This product is supplied subject to the terms and conditions, including the limited license, located at www.biolegend.com/terms) ("Terms") and may be used only as provided in the Terms. Without limiting the foregoing, BioLegend products may not be used for any Commercial Purpose as defined in the Terms, resold in any form, used in manufacturing, or reverse engineered, sequenced, or otherwise studied or used to learn its design or composition without express written approval of BioLegend. Regardless of the information given in this document, user is solely responsible for determining any license requirements necessary for user’s intended use and assumes all risk and liability arising from use of the product. BioLegend is not responsible for patent infringement or any other risks or liabilities whatsoever resulting from the use of its products.

 

BioLegend, the BioLegend logo, and all other trademarks are property of BioLegend, Inc. or their respective owners, and all rights are reserved.

 

8999 BioLegend Way, San Diego, CA 92121 www.biolegend.com
Toll-Free Phone: 1-877-Bio-Legend (246-5343) Phone: (858) 768-5800 Fax: (877) 455-9587

ProductsHere

Login / Register
Remember me
Forgot your password? Reset password?
Create an Account