- Regulatory Status
- RUO
- Other Names
- Osteocalcin, uncarboxylated osteocalcin, decarboxylated osteocalcin, 3xGlu, bone gamma-carboxyglutamate protein, Bone Gla Protein, BGP, OC, OCN, unOCN
- Ave. Rating
- Submit a Review
- Product Citations
- publications
Cat # | Size | Price | Quantity Check Availability | Save | ||
---|---|---|---|---|---|---|
446709 | 4 pack | 94 CHF |
Osteocalcin is the most abundant non-collagenous protein found in the bone. While fully-carboxylated osteocalcin has a high affinity for the extracellular matrix of the bone; decreases in pH, caused by the process of bone resorption, result in decarboxylation of this protein. This generates both partially decarboxylated (undercarboxylated) and fully decarboxylated (uncarboxylated) osteocalcin molecules which are released into the circulation due to decreased affinity for the extracellular matrix. Fully carboxylated osteocalcin requires high calcium concentrations for proper protein folding; however, under/uncarboxylated osteocalcin has no calcium requirement to maintain its structure within the blood.
Product DetailsProduct Details
- Source
- YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (synthetic peptide)
- Molecular Mass
- 33.2 kD
- Purity
- > 90%
- Formulation
- Lyophilized in sterile-filtered PBS, pH 7.2, containing 1% BSA, 0.09% sodium azide, and protease inhibitors
- Concentration
- Lot-specific (to obtain lot-specific concentration and expiration, please enter the lot number in our Certificate of Analysis online tool.)
- Storage & Handling
- Unopened vials can be stored between 2°C and 8°C until the expiration date. Prior to use, reconstitute the lyophilized powder with 0.2 mL of PBS containing a carrier protein (e.g., 1% BSA, protease free), pH7.4. Re-cap vial, vortex. Allow the reconstituted standard to sit at room temperature for 15 minutes, vortex again to mix completely. The reconstituted standard stock solution can be aliquoted into polypropylene vials and stored at -70°C for up to one month. Do not re-use diluted standards. Avoid repeated freeze/thaw cycles.
- Activity
-
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
It is a synthetic peptide (did not test activity) - Application
-
ELISA - Quality tested
- Recommended Usage
-
Each lot of this protein is quality control tested by ELISA assay. For use as an ELISA standard, a standard curve comprised of doubling dilutions from 37.5 - 2400 pg/mL is suggested. It is recommended that the reagent be titrated for optimal performance for each application.
- Application Notes
-
This Uncarboxylated Osteocalcin protein is useful as a standard for a human Osteocalcin sandwich ELISA, using unlabeled 8H4 antibody (Cat. No. 538202) as capture and biotinylated 4B6 antibody (Cat. No. 538304) as detection.
Antigen Details
- Structure
- Monomer
- Distribution
-
Osteocalcin is produced by osteoblasts as a 49 amino acid protein, which contains 3 glutamine acid residues (Glu 17, 21, and 24) that are gamma carboxylated in a vitamin K dependent manner.
- Function
- Once binded under/uncarboxylated forms act as hormones promoting β-cell proliferation, adiponectin secretion, insulin sensitivity, glucose tolerance, and testosterone biosynthesis. In patients with diabetes, reduced serum levels of osteocalcin are negatively correlated with obesity and insulin resistance. Furthermore, supporting studies in mice have suggested potential therapeutic applications for osteocalcin in both obesity and insulin resistance.
- Interaction
- GPRC6A, insulin, pancreatic β-cells, Ley-dig cells, adiponectin
- Ligand/Receptor
- Under/uncarboxylated forms can bind the receptor GPCR6a, calcium, and metal-binding.
- Bioactivity
-
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Immunogen is a synthetic peptide (did not test activity) - Cell Type
- Osteoblasts
- Molecular Family
- Hormones
- Antigen References
-
- Booth SL, et al. 2013. Nat Rev Endocrinol. 9:43.
- Diaz-Franco MC, et al. 2019. Mol Med Rep. 19:15-22.
- Karsenty G, et al. 2014. Mol Cell Endocrinol. 382:521.
- Zoch ML, et al. 2016. Bone. 82:42-9.
- Gene ID
- 632 View all products for this Gene ID
- UniProt
- View information about Uncarboxylated Osteocalcin on UniProt.org
Follow Us